Lineage for d1cpt__ (1cpt -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5730Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 5731Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 5732Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 5818Protein Cytochrome P450-TERP [48274] (1 species)
  7. 5819Species Pseudomonas sp. [TaxId:306] [48275] (1 PDB entry)
  8. 5820Domain d1cpt__: 1cpt - [18968]

Details for d1cpt__

PDB Entry: 1cpt (more details), 2.3 Å

PDB Description: crystal structure and refinement of cytochrome p450-terp at 2.3 angstroms resolution

SCOP Domain Sequences for d1cpt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpt__ a.104.1.1 (-) Cytochrome P450-TERP {Pseudomonas sp.}
mdaratipehiartvilpqgyaddeviypafkwlrdeqplamahiegydpmwiatkhadv
mqigkqpglfsnaegseilydqnneafmrsisggcphvidsltsmdppthtayrgltlnw
fqpasirkleenirriaqasvqrlldfdgecdfmtdcalyyplhvvmtalgvpeddeplm
lkltqdffgveaarrfhetiatfydyfngftvdrrscpkddvmsllanskldgnyiddky
inayyvaiataghdttssssggaiiglsrnpeqlalaksdpaliprlvdeavrwtapvks
fmrtaladtevrgqnikrgdrimlsypsanrdeevfsnpdefditrfpnrhlgfgwgahm
clgqhlaklemkiffeellpklksvelsgpprlvatnfvggpknvpirftka

SCOP Domain Coordinates for d1cpt__:

Click to download the PDB-style file with coordinates for d1cpt__.
(The format of our PDB-style files is described here.)

Timeline for d1cpt__: