Lineage for d1cpta_ (1cpt A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. Protein Cytochrome P450-TERP [48274] (1 species)
  7. Species Pseudomonas sp. [TaxId:306] [48275] (1 PDB entry)
  8. Domain d1cpta_: 1cpt A: [18968]
    complexed with hem

Details for d1cpta_

PDB Entry: 1cpt (more details), 2.3 Å

PDB Description: crystal structure and refinement of cytochrome p450-terp at 2.3 angstroms resolution
PDB Compounds: (A:) cytochrome p450-terp

SCOPe Domain Sequences for d1cpta_:

Sequence, based on SEQRES records: (download)

>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]}
mdaratipehiartvilpqgyaddeviypafkwlrdeqplamahiegydpmwiatkhadv
mqigkqpglfsnaegseilydqnneafmrsisggcphvidsltsmdppthtayrgltlnw
fqpasirkleenirriaqasvqrlldfdgecdfmtdcalyyplhvvmtalgvpeddeplm
lkltqdffgvhepdeqavaaprqsadeaarrfhetiatfydyfngftvdrrscpkddvms
llanskldgnyiddkyinayyvaiataghdttssssggaiiglsrnpeqlalaksdpali
prlvdeavrwtapvksfmrtaladtevrgqnikrgdrimlsypsanrdeevfsnpdefdi
trfpnrhlgfgwgahmclgqhlaklemkiffeellpklksvelsgpprlvatnfvggpkn
vpirftka

Sequence, based on observed residues (ATOM records): (download)

>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]}
mdaratipehiartvilpqgyaddeviypafkwlrdeqplamahiegydpmwiatkhadv
mqigkqpglfsnaegseilydqnneafmrsisggcphvidsltsmdppthtayrgltlnw
fqpasirkleenirriaqasvqrlldfdgecdfmtdcalyyplhvvmtalgvpeddeplm
lkltqdffgveaarrfhetiatfydyfngftvdrrscpkddvmsllanskldgnyiddky
inayyvaiataghdttssssggaiiglsrnpeqlalaksdpaliprlvdeavrwtapvks
fmrtaladtevrgqnikrgdrimlsypsanrdeevfsnpdefditrfpnrhlgfgwgahm
clgqhlaklemkiffeellpklksvelsgpprlvatnfvggpknvpirftka

SCOPe Domain Coordinates for d1cpta_ are not available.

Timeline for d1cpta_: