Lineage for d1oxaa_ (1oxa A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005312Protein Cytochrome P450-ERYF [48272] (1 species)
  7. 2005313Species Saccharopolyspora erythraea [TaxId:1836] [48273] (10 PDB entries)
  8. 2005321Domain d1oxaa_: 1oxa A: [18965]
    CASP1
    complexed with deb, hem

Details for d1oxaa_

PDB Entry: 1oxa (more details), 2.1 Å

PDB Description: cytochrome p450 (donor:o2 oxidoreductase)
PDB Compounds: (A:) cytochrome p450 eryf

SCOPe Domain Sequences for d1oxaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxaa_ a.104.1.1 (A:) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]}
atvpdlesdsfhvdwystyaelretapvtpvrflgqdawlvtgydeakaalsdlrlssdp
kkkypgvevefpaylgfpedvrnyfatnmgtsdppthtrlrklvsqeftvrrveamrprv
eqitaelldevgdsgvvdivdrfahplpikvicellgvdeaargafgrwsseilvmdper
aeqrgqaarevvnfildlverrrtepgddllsalisvqddddgrlsadeltsialvllla
gfeasvsligigtylllthpdqlalvradpsalpnaveeilryiappetttrfaaeevei
ggvaipqystvlvangaanrdpsqfpdphrfdvtrdtrghlsfgqgihfcmgrplakleg
evalralfgrfpalslgidaddvvwrrslllrgidhlpvrldg

SCOPe Domain Coordinates for d1oxaa_:

Click to download the PDB-style file with coordinates for d1oxaa_.
(The format of our PDB-style files is described here.)

Timeline for d1oxaa_: