Lineage for d2rom__ (2rom -)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily) Superfamily a.104.1: Cytochrome P450 [48264] (1 family) 
Family a.104.1.1: Cytochrome P450 [48265] (8 proteins) Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species) Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (16 PDB entries) 
Domain d2rom__: 2rom - [18962]
Details for d2rom__
PDB Entry: 2rom (more details), 2 Å
PDB Description: crystal structure of nitric reductase from denitrifying fungus fusarium oxysporum complex with carbon monoxide
SCOP Domain Sequences for d2rom__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rom__ a.104.1.1 (-) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum)}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
SCOP Domain Coordinates for d2rom__:
Click to download the PDB-style file with coordinates for d2rom__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rom__:
- d2rom__ first appeared (with stable ids) in SCOP 1.55
- d2rom__ appears in SCOP 1.57
- d2rom__ appears in SCOP 1.61
- d2rom__ appears in the current release, SCOPe 2.08, called d2roma_
View in 3D