Lineage for d2rom__ (2rom -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5730Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 5731Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 5732Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 5802Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species)
  7. 5803Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (14 PDB entries)
  8. 5815Domain d2rom__: 2rom - [18962]

Details for d2rom__

PDB Entry: 2rom (more details), 2 Å

PDB Description: crystal structure of nitric reductase from denitrifying fungus fusarium oxysporum complex with carbon monoxide

SCOP Domain Sequences for d2rom__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rom__ a.104.1.1 (-) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum)}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif

SCOP Domain Coordinates for d2rom__:

Click to download the PDB-style file with coordinates for d2rom__.
(The format of our PDB-style files is described here.)

Timeline for d2rom__: