Lineage for d1cl6a_ (1cl6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005324Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species)
  7. 2005325Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (18 PDB entries)
    Uniprot P23295
  8. 2005337Domain d1cl6a_: 1cl6 A: [18960]
    complexed with hem, no; mutant

Details for d1cl6a_

PDB Entry: 1cl6 (more details), 1.7 Å

PDB Description: crystal structures of ferric-no complexes of fungal nitric oxide reductase and its ser286 mutants at cryogenic temperature
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d1cl6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cl6a_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif

SCOPe Domain Coordinates for d1cl6a_:

Click to download the PDB-style file with coordinates for d1cl6a_.
(The format of our PDB-style files is described here.)

Timeline for d1cl6a_: