Lineage for d1f24a_ (1f24 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50174Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 50175Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 50176Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 50253Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species)
  7. 50254Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (14 PDB entries)
  8. 50255Domain d1f24a_: 1f24 A: [18953]

Details for d1f24a_

PDB Entry: 1f24 (more details), 1.4 Å

PDB Description: crystal structure of no complex of thr243ala mutants of cytochrome p450nor

SCOP Domain Sequences for d1f24a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f24a_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum)}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnaam
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif

SCOP Domain Coordinates for d1f24a_:

Click to download the PDB-style file with coordinates for d1f24a_.
(The format of our PDB-style files is described here.)

Timeline for d1f24a_: