Lineage for d1f25a_ (1f25 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5730Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 5731Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 5732Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 5802Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species)
  7. 5803Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (14 PDB entries)
  8. 5805Domain d1f25a_: 1f25 A: [18952]

Details for d1f25a_

PDB Entry: 1f25 (more details), 1.4 Å

PDB Description: crystal structure of no complex of thr243asn mutants of cytochrome p450nor

SCOP Domain Sequences for d1f25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f25a_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum)}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnanm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif

SCOP Domain Coordinates for d1f25a_:

Click to download the PDB-style file with coordinates for d1f25a_.
(The format of our PDB-style files is described here.)

Timeline for d1f25a_: