Lineage for d1faga_ (1fag A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5730Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 5731Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 5732Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 5745Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 5746Species Bacillus megaterium [TaxId:1404] [48269] (6 PDB entries)
  8. 5757Domain d1faga_: 1fag A: [18947]

Details for d1faga_

PDB Entry: 1fag (more details), 2.7 Å

PDB Description: structure of cytochrome p450

SCOP Domain Sequences for d1faga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1faga_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkipl

SCOP Domain Coordinates for d1faga_:

Click to download the PDB-style file with coordinates for d1faga_.
(The format of our PDB-style files is described here.)

Timeline for d1faga_: