Lineage for d1bvyb_ (1bvy B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005023Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 2005024Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2005119Domain d1bvyb_: 1bvy B: [18944]
    Other proteins in same PDB: d1bvyf_
    complexed with edo, fmn, hem

Details for d1bvyb_

PDB Entry: 1bvy (more details), 2.03 Å

PDB Description: complex of the heme and fmn-binding domains of the cytochrome p450(bm-3)
PDB Compounds: (B:) protein (cytochrome p450 bm-3)

SCOPe Domain Sequences for d1bvyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvyb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
ntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacdesrfdknlsqalkfvrd
fagdglftswtheknwkkahnillpsfsqqamkgyhammvdiavqlvqkwerlnadehie
vpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldeamnklqranpddpayde
nkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeniryqiit
fliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvgmvlne
alrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefrperfe
npsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldiketltlk
pegfvvkakskkiplggi

SCOPe Domain Coordinates for d1bvyb_:

Click to download the PDB-style file with coordinates for d1bvyb_.
(The format of our PDB-style files is described here.)

Timeline for d1bvyb_: