Lineage for d1bvya_ (1bvy A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446992Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 446993Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 446994Family a.104.1.1: Cytochrome P450 [48265] (20 proteins)
  6. 447035Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 447036Species Bacillus megaterium [TaxId:1404] [48269] (13 PDB entries)
  8. 447053Domain d1bvya_: 1bvy A: [18943]
    Other proteins in same PDB: d1bvyf_

Details for d1bvya_

PDB Entry: 1bvy (more details), 2.03 Å

PDB Description: complex of the heme and fmn-binding domains of the cytochrome p450(bm-3)

SCOP Domain Sequences for d1bvya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvya_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium}
lntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacdesrfdknlsqalkfvr
dfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiavqlvqkwerlnadehi
evpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldeamnklqranpddpayd
enkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeniryqii
tfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvgmvln
ealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefrperf
enpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldiketltl
kpegfvvkakskkiplggi

SCOP Domain Coordinates for d1bvya_:

Click to download the PDB-style file with coordinates for d1bvya_.
(The format of our PDB-style files is described here.)

Timeline for d1bvya_: