Lineage for d2bmhb_ (2bmh B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50174Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 50175Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 50176Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 50193Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 50194Species Bacillus megaterium [TaxId:1404] [48269] (6 PDB entries)
  8. 50200Domain d2bmhb_: 2bmh B: [18942]

Details for d2bmhb_

PDB Entry: 2bmh (more details), 2 Å

PDB Description: modeling protein-substrate interactions in the heme domain of cytochrome p450bm-3

SCOP Domain Sequences for d2bmhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmhb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkipl

SCOP Domain Coordinates for d2bmhb_:

Click to download the PDB-style file with coordinates for d2bmhb_.
(The format of our PDB-style files is described here.)

Timeline for d2bmhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bmha_