Lineage for d2bmha_ (2bmh A:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 155466Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 155467Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 155484Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 155485Species Bacillus megaterium [TaxId:1404] [48269] (8 PDB entries)
  8. 155494Domain d2bmha_: 2bmh A: [18941]

Details for d2bmha_

PDB Entry: 2bmh (more details), 2 Å

PDB Description: modeling protein-substrate interactions in the heme domain of cytochrome p450bm-3

SCOP Domain Sequences for d2bmha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmha_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkipl

SCOP Domain Coordinates for d2bmha_:

Click to download the PDB-style file with coordinates for d2bmha_.
(The format of our PDB-style files is described here.)

Timeline for d2bmha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bmhb_