Lineage for d2hpdb_ (2hpd B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646395Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 646396Species Bacillus megaterium [TaxId:1404] [48269] (18 PDB entries)
  8. 646416Domain d2hpdb_: 2hpd B: [18940]
    complexed with hem

Details for d2hpdb_

PDB Entry: 2hpd (more details), 2 Å

PDB Description: crystal structure of hemoprotein domain of p450bm-3, a prototype for microsomal p450's
PDB Compounds: (B:) cytochrome p450 bm-3

SCOP Domain Sequences for d2hpdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hpdb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkiplgg

SCOP Domain Coordinates for d2hpdb_:

Click to download the PDB-style file with coordinates for d2hpdb_.
(The format of our PDB-style files is described here.)

Timeline for d2hpdb_: