Lineage for d2hpda_ (2hpd A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542252Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 542253Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 542254Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 542301Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 542302Species Bacillus megaterium [TaxId:1404] [48269] (13 PDB entries)
  8. 542313Domain d2hpda_: 2hpd A: [18939]

Details for d2hpda_

PDB Entry: 2hpd (more details), 2 Å

PDB Description: crystal structure of hemoprotein domain of p450bm-3, a prototype for microsomal p450's

SCOP Domain Sequences for d2hpda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hpda_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketltlkpegfvvkakskkiplgg

SCOP Domain Coordinates for d2hpda_:

Click to download the PDB-style file with coordinates for d2hpda_.
(The format of our PDB-style files is described here.)

Timeline for d2hpda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hpdb_