Lineage for d3cp4__ (3cp4 -)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216631Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 216632Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 216633Family a.104.1.1: Cytochrome P450 [48265] (12 proteins)
  6. 216682Protein Cytochrome P450-CAM [48266] (1 species)
  7. 216683Species Pseudomonas putida [TaxId:303] [48267] (40 PDB entries)
  8. 216732Domain d3cp4__: 3cp4 - [18936]
    complexed with adm, hem

Details for d3cp4__

PDB Entry: 3cp4 (more details), 2.3 Å

PDB Description: crystal structure of the cytochrome p450-cam active site mutant thr252ala

SCOP Domain Sequences for d3cp4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cp4__ a.104.1.1 (-) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d3cp4__:

Click to download the PDB-style file with coordinates for d3cp4__.
(The format of our PDB-style files is described here.)

Timeline for d3cp4__: