Lineage for d4cpp__ (4cpp -)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284545Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 284546Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 284547Family a.104.1.1: Cytochrome P450 [48265] (14 proteins)
  6. 284607Protein Cytochrome P450-CAM [48266] (1 species)
  7. 284608Species Pseudomonas putida [TaxId:303] [48267] (40 PDB entries)
  8. 284650Domain d4cpp__: 4cpp - [18934]
    complexed with adm, hem

Details for d4cpp__

PDB Entry: 4cpp (more details), 2.11 Å

PDB Description: crystal structures of cytochrome p450-cam complexed with camphane, thiocamphor, and adamantane: factors controlling p450 substrate hydroxylation

SCOP Domain Sequences for d4cpp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpp__ a.104.1.1 (-) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d4cpp__:

Click to download the PDB-style file with coordinates for d4cpp__.
(The format of our PDB-style files is described here.)

Timeline for d4cpp__: