Lineage for d8cpp__ (8cpp -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50174Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 50175Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 50176Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 50209Protein Cytochrome P450-CAM [48266] (1 species)
  7. 50210Species Pseudomonas putida [TaxId:303] [48267] (32 PDB entries)
  8. 50238Domain d8cpp__: 8cpp - [18930]

Details for d8cpp__

PDB Entry: 8cpp (more details), 2.1 Å

PDB Description: crystal structures of cytochrome p450-cam complexed with camphane, thiocamphor, and adamantane: factors controlling p450 substrate hydroxylation

SCOP Domain Sequences for d8cpp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d8cpp__ a.104.1.1 (-) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d8cpp__:

Click to download the PDB-style file with coordinates for d8cpp__.
(The format of our PDB-style files is described here.)

Timeline for d8cpp__: