Lineage for d6cp4a_ (6cp4 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1743742Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1743964Protein Cytochrome P450-CAM [48266] (1 species)
  7. 1743965Species Pseudomonas putida [TaxId:303] [48267] (108 PDB entries)
    Uniprot P00183
  8. 1744028Domain d6cp4a_: 6cp4 A: [18924]
    complexed with cam, gol, hem, k; mutant

Details for d6cp4a_

PDB Entry: 6cp4 (more details), 1.9 Å

PDB Description: p450cam d251n mutant
PDB Compounds: (A:) cytochrome p450cam

SCOPe Domain Sequences for d6cp4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cp4a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
lntvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d6cp4a_:

Click to download the PDB-style file with coordinates for d6cp4a_.
(The format of our PDB-style files is described here.)

Timeline for d6cp4a_: