Lineage for d1akd__ (1akd -)
- Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily)
multihelicalSuperfamily a.104.1: Cytochrome P450 [48264] (1 family) 
Family a.104.1.1: Cytochrome P450 [48265] (21 proteins) 
Protein Cytochrome P450-CAM [48266] (1 species) Species Pseudomonas putida [TaxId:303] [48267] (48 PDB entries) 
Domain d1akd__: 1akd - [18923]
complexed with cam, hem, k
Details for d1akd__
PDB Entry: 1akd (more details), 1.8 Å
PDB Description: cytochrome p450cam from pseudomonas putida, complexed with 1s-camphor
SCOP Domain Sequences for d1akd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1akd__ a.104.1.1 (-) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
SCOP Domain Coordinates for d1akd__:
Click to download the PDB-style file with coordinates for d1akd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1akd__:
- d1akd__ first appeared (with stable ids) in SCOP 1.55
- d1akd__ appears in SCOP 1.69
- d1akd__ is called d1akda_ in SCOP 1.73
- d1akd__ appears in the current release, SCOPe 2.08, called d1akda_
View in 3D