Lineage for d1akd__ (1akd -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50174Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 50175Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 50176Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 50209Protein Cytochrome P450-CAM [48266] (1 species)
  7. 50210Species Pseudomonas putida [TaxId:303] [48267] (32 PDB entries)
  8. 50229Domain d1akd__: 1akd - [18923]

Details for d1akd__

PDB Entry: 1akd (more details), 1.8 Å

PDB Description: cytochrome p450cam from pseudomonas putida, complexed with 1s-camphor

SCOP Domain Sequences for d1akd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akd__ a.104.1.1 (-) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1akd__:

Click to download the PDB-style file with coordinates for d1akd__.
(The format of our PDB-style files is described here.)

Timeline for d1akd__: