Lineage for d7cpp__ (7cpp -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.104: Cytochrome P450 [48263] (1 superfamily) Superfamily a.104.1: Cytochrome P450 [48264] (1 family) 
Family a.104.1.1: Cytochrome P450 [48265] (8 proteins) 
Protein Cytochrome P450-CAM [48266] (1 species) Species Pseudomonas putida [TaxId:303] [48267] (30 PDB entries) 
Domain d7cpp__: 7cpp - [18922]
Details for d7cpp__
PDB Entry: 7cpp (more details), 2 Å
PDB Description: the structural basis for substrate-induced changes in redox potential and spin equilibrium in cytochrome p450(cam)
SCOP Domain Sequences for d7cpp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cpp__ a.104.1.1 (-) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
SCOP Domain Coordinates for d7cpp__:
Click to download the PDB-style file with coordinates for d7cpp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7cpp__:
- d7cpp__ appears in SCOP 1.57
- d7cpp__ appears in the current release, SCOPe 2.08, called d7cppa_
View in 3D