Lineage for d1cp4__ (1cp4 -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50174Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 50175Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 50176Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 50209Protein Cytochrome P450-CAM [48266] (1 species)
  7. 50210Species Pseudomonas putida [TaxId:303] [48267] (32 PDB entries)
  8. 50230Domain d1cp4__: 1cp4 - [18921]

Details for d1cp4__

PDB Entry: 1cp4 (more details), 1.9 Å

PDB Description: formation, crystal structure, and rearrangement of a cytochrome p450- cam iron-phenyl complex

SCOP Domain Sequences for d1cp4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cp4__ a.104.1.1 (-) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1cp4__:

Click to download the PDB-style file with coordinates for d1cp4__.
(The format of our PDB-style files is described here.)

Timeline for d1cp4__: