Lineage for d1dz8b_ (1dz8 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5730Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 5731Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 5732Family a.104.1.1: Cytochrome P450 [48265] (8 protein domains)
  6. 5761Protein Cytochrome P450-CAM [48266] (1 species)
  7. 5762Species Pseudomonas putida [TaxId:303] [48267] (30 PDB entries)
  8. 5777Domain d1dz8b_: 1dz8 B: [18917]

Details for d1dz8b_

PDB Entry: 1dz8 (more details), 1.9 Å

PDB Description: oxygen complex of p450cam from pseudomonas putida

SCOP Domain Sequences for d1dz8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dz8b_ a.104.1.1 (B:) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1dz8b_:

Click to download the PDB-style file with coordinates for d1dz8b_.
(The format of our PDB-style files is described here.)

Timeline for d1dz8b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dz8a_