Lineage for d1dz8a_ (1dz8 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50174Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 50175Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 50176Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 50209Protein Cytochrome P450-CAM [48266] (1 species)
  7. 50210Species Pseudomonas putida [TaxId:303] [48267] (32 PDB entries)
  8. 50224Domain d1dz8a_: 1dz8 A: [18916]

Details for d1dz8a_

PDB Entry: 1dz8 (more details), 1.9 Å

PDB Description: oxygen complex of p450cam from pseudomonas putida

SCOP Domain Sequences for d1dz8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dz8a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida}
laplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgql
ireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklenr
iqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgs
mtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggl
dtvvnflsfsmeflakspehrqeliqrperipaaceellrrfslvadgriltsdyefhgv
qlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiivt
lkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1dz8a_:

Click to download the PDB-style file with coordinates for d1dz8a_.
(The format of our PDB-style files is described here.)

Timeline for d1dz8a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dz8b_