Lineage for d5cp4__ (5cp4 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5730Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 5731Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 5732Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 5761Protein Cytochrome P450-CAM [48266] (1 species)
  7. 5762Species Pseudomonas putida [TaxId:303] [48267] (30 PDB entries)
  8. 5774Domain d5cp4__: 5cp4 - [18914]

Details for d5cp4__

PDB Entry: 5cp4 (more details), 1.75 Å

PDB Description: cryogenic structure of p450cam

SCOP Domain Sequences for d5cp4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cp4__ a.104.1.1 (-) Cytochrome P450-CAM {Pseudomonas putida}
anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
gvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreii
vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d5cp4__:

Click to download the PDB-style file with coordinates for d5cp4__.
(The format of our PDB-style files is described here.)

Timeline for d5cp4__: