Lineage for d1phd__ (1phd -)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 155466Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 155467Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 155504Protein Cytochrome P450-CAM [48266] (1 species)
  7. 155505Species Pseudomonas putida [TaxId:303] [48267] (37 PDB entries)
  8. 155513Domain d1phd__: 1phd - [18913]

Details for d1phd__

PDB Entry: 1phd (more details), 1.6 Å

PDB Description: crystal structures of metyrapone-and phenylimidazole-inhibited complexes of cytochrome p450-cam

SCOP Domain Sequences for d1phd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1phd__ a.104.1.1 (-) Cytochrome P450-CAM {Pseudomonas putida}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d1phd__:

Click to download the PDB-style file with coordinates for d1phd__.
(The format of our PDB-style files is described here.)

Timeline for d1phd__: