Lineage for d1a59a_ (1a59 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2722946Protein Citrate synthase [48258] (7 species)
  7. 2722947Species Antarctic bacterium DS2-3R [TaxId:56673] [48262] (1 PDB entry)
    Cold-active enzyme
  8. 2722948Domain d1a59a_: 1a59 A: [18902]
    complexed with cit, coa

Details for d1a59a_

PDB Entry: 1a59 (more details), 2.09 Å

PDB Description: cold-active citrate synthase
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d1a59a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a59a_ a.103.1.1 (A:) Citrate synthase {Antarctic bacterium DS2-3R [TaxId: 56673]}
eptihkglagvtadvtaiskvnsdtnsllyrgypvqelaakcsfeqvayllwnselpnds
elkafvnfershrkldenvkgaidllstachpmdvartavsvlganharaqdsspeanle
kamsllatfpsvvaydqrrrrgeeliepredldysanflwmtfgeeaapevveafnvsmi
lyaehsfnastftarvitstladlhsavtgaigalkgplhgganeavmhtfeeigirkde
sldeaatrskawmvdalaqkkkvmgfghrvykngdsrvptmksaldamikhydrpemlgl
yngleaameeakqikpnldypagptynlmgfdtemftplfiaaritgwtahimeqvadna
lirplseyngpeqrqvp

SCOPe Domain Coordinates for d1a59a_:

Click to download the PDB-style file with coordinates for d1a59a_.
(The format of our PDB-style files is described here.)

Timeline for d1a59a_: