Lineage for d1a59a_ (1a59 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. Protein Citrate synthase [48258] (7 species)
  7. Species Antarctic bacterium DS2-3R [TaxId:56673] [48262] (1 PDB entry)
    Cold-active enzyme
  8. Domain d1a59a_: 1a59 A: [18902]
    complexed with cit, coa

Details for d1a59a_

PDB Entry: 1a59 (more details), 2.09 Å

PDB Description: cold-active citrate synthase
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d1a59a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a59a_ a.103.1.1 (A:) Citrate synthase {Antarctic bacterium DS2-3R [TaxId: 56673]}
eptihkglagvtadvtaiskvnsdtnsllyrgypvqelaakcsfeqvayllwnselpnds
elkafvnfershrkldenvkgaidllstachpmdvartavsvlganharaqdsspeanle
kamsllatfpsvvaydqrrrrgeeliepredldysanflwmtfgeeaapevveafnvsmi
lyaehsfnastftarvitstladlhsavtgaigalkgplhgganeavmhtfeeigirkde
sldeaatrskawmvdalaqkkkvmgfghrvykngdsrvptmksaldamikhydrpemlgl
yngleaameeakqikpnldypagptynlmgfdtemftplfiaaritgwtahimeqvadna
lirplseyngpeqrqvp

SCOPe Domain Coordinates for d1a59a_ are not available.

Timeline for d1a59a_: