Lineage for d1cts__ (1cts -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5699Fold a.103: Citrate synthase [48255] (1 superfamily)
  4. 5700Superfamily a.103.1: Citrate synthase [48256] (1 family) (S)
  5. 5701Family a.103.1.1: Citrate synthase [48257] (1 protein)
  6. 5702Protein Citrate synthase [48258] (4 species)
  7. 5722Species Pig (Sus scrofa) [TaxId:9823] [48260] (3 PDB entries)
  8. 5724Domain d1cts__: 1cts - [18897]

Details for d1cts__

PDB Entry: 1cts (more details), 2.7 Å

PDB Description: crystallographic refinement and atomic models of two different forms of citrate synthase at 2.7 and 1.7 angstroms resolution

SCOP Domain Sequences for d1cts__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cts__ a.103.1.1 (-) Citrate synthase {Pig (Sus scrofa)}
asstnlkdiladlipkeqariktfrqqhgntvvgqitvdmmyggmrgmkglvyetsvldp
degirfrgysipecqkmlpkakggeeplpeglfwllvtgqipteeqvswlskewakraal
pshvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegihrtkyweliyedcmdlia
klpcvaakiyrnlyregssigaidskldwshnftnmlgytdaqftelmrlyltihsdheg
gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
lrdyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlphdpmfklvaqlykivpnv
lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
rpksmstdgliklvdsk

SCOP Domain Coordinates for d1cts__:

Click to download the PDB-style file with coordinates for d1cts__.
(The format of our PDB-style files is described here.)

Timeline for d1cts__: