SCOPe 2.07: Domain d2ctsa_: 2cts A:

Lineage for d2ctsa_ (2cts A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain
   automatically mapped to Pfam PF00285

6. Protein Citrate synthase [48258] (7 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [48260] (4 PDB entries)

8. Domain d2ctsa_: 2cts A: [18896]
   complexed with cit, coa

Details for d2ctsa_

PDB Entry: 2cts, 2 Å

PDB Description: crystallographic refinement and atomic models of two different forms of citrate synthase at 2.7 and 1.7 angstroms resolution

PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d2ctsa_:

Sequence; same for both SEQRES and ATOM records:

>d2ctsa_ a.103.1.1 (A:) Citrate synthase {Pig (Sus scrofa) [TaxId: 9823]}
asstnlkdiladlipkeqariktfrqqhgntavgqitvdmmyggmrgmkglvyetsvldp
degirfrgysipecqkmlpkakggeeplpeglfwllvtgqipteeqvswlskewakraal
pshvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegihrtkyweliyedcmdlia
klpcvaakiyrnlyregssigaidskldwshnftnmlgytdaqftelmrlyltihsdheg
gnvsahtshlvgsalsdpylsfaaamnglagplhglanqevlvwltqlqkevgkdvsdek
lrdyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlphdpmfklvaqlykivpnv
lleqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfple
rpksmstdgliklvdsk

Timeline for d2ctsa_:

• d2ctsa_ first appeared (with stable ids) in SCOP 1.55, called d2cts__
  
• d2ctsa_ appears in SCOPe 2.06
  
• d2ctsa_ appears in the current release, SCOPe 2.08