Lineage for d5cscb_ (5csc B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004800Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2004801Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2004802Family a.103.1.1: Citrate synthase [48257] (2 protein domains)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2004803Protein Citrate synthase [48258] (7 species)
  7. 2004806Species Chicken (Gallus gallus) [TaxId:9031] [48259] (14 PDB entries)
  8. 2004822Domain d5cscb_: 5csc B: [18895]

Details for d5cscb_

PDB Entry: 5csc (more details), 2.8 Å

PDB Description: structure of an open form of chicken heart citrate synthase at 2.8 angstroms resolution
PDB Compounds: (B:) citrate synthase

SCOPe Domain Sequences for d5cscb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cscb_ a.103.1.1 (B:) Citrate synthase {Chicken (Gallus gallus) [TaxId: 9031]}
asstnlkdvlaalipkeqariktfrqqhggtalgqitvdmsyggmrgmkglvyetsvldp
degirfrgfsipecqkllpkggggeplpeglfwllvtgqiptgaqvswlskewakraalp
shvvtmldnfptnlhpmsqlsaaitalnsesnfarayaegilrtkywemvyesamdliak
lpcvaakiyrnlyragssigaidskldwshnftnmlgytdaqftelmrlyltihsdhegg
nvsahtshlvgsalsdpylsfaaamnglagplhglanqevlgwlaqlqkaagadaslrdy
iwntlnsgrvvpgyghavlrktdprytcqrefalkhlpgdpmfklvaqlykivpnvlleq
gaaanpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerpks
mstdglial

SCOPe Domain Coordinates for d5cscb_:

Click to download the PDB-style file with coordinates for d5cscb_.
(The format of our PDB-style files is described here.)

Timeline for d5cscb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5csca_