Lineage for d1csr__ (1csr -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5699Fold a.103: Citrate synthase [48255] (1 superfamily)
  4. 5700Superfamily a.103.1: Citrate synthase [48256] (1 family) (S)
  5. 5701Family a.103.1.1: Citrate synthase [48257] (1 protein)
  6. 5702Protein Citrate synthase [48258] (4 species)
  7. 5705Species Chicken (Gallus gallus) [TaxId:9031] [48259] (14 PDB entries)
  8. 5710Domain d1csr__: 1csr - [18883]

Details for d1csr__

PDB Entry: 1csr (more details), 1.7 Å

PDB Description: alpha-fluoro acid and alpha-fluoro amide analogs of acetyl-coa as inhibitors of of citrate synthase: effect of pka matching on binding affinity and hydrogen bond length

SCOP Domain Sequences for d1csr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csr__ a.103.1.1 (-) Citrate synthase {Chicken (Gallus gallus)}
stnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldpde
girfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraalps
hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdliakl
pcvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheggn
vsahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdeklr
dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnvll
eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp
ksmstagleklsagg

SCOP Domain Coordinates for d1csr__:

Click to download the PDB-style file with coordinates for d1csr__.
(The format of our PDB-style files is described here.)

Timeline for d1csr__: