![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (2 families) ![]() |
![]() | Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
![]() | Protein Citrate synthase [48258] (7 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [48259] (14 PDB entries) |
![]() | Domain d1csra_: 1csr A: [18883] complexed with fam, oaa |
PDB Entry: 1csr (more details), 1.7 Å
SCOPe Domain Sequences for d1csra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1csra_ a.103.1.1 (A:) Citrate synthase {Chicken (Gallus gallus) [TaxId: 9031]} stnlkdvlaslipkeqariktfrqqhgntavgqitvdmsyggmrgmkgliyetsvldpde girfrgfsipecqkllpkagggeeplpeglfwllvtgqiptpeqvswvskewakraalps hvvtmldnfptnlhpmsqlsaaitalnsesnfarayaeginrtkywefvyedamdliakl pcvaakiyrnlyragssigaidskldwshnftnmlgytdpqftelmrlyltihsdheggn vsahtshlvgsalsdpylsfaaamnglagplhglanqevllwlsqlqkdlgadasdeklr dyiwntlnsgrvvpgyghavlrktdprytcqrefalkhlpsdpmfklvaqlykivpnvll eqgkaknpwpnvdahsgvllqyygmtemnyytvlfgvsralgvlaqliwsralgfplerp ksmstagleklsagg
Timeline for d1csra_: