Lineage for d1qsjb_ (1qsj B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2007005Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2007408Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2007681Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 2007685Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 2007720Species Norway rat (Rattus norvegicus) [TaxId:10116] [48254] (2 PDB entries)
  8. 2007723Domain d1qsjb_: 1qsj B: [18877]
    N-terminally truncated fragment

Details for d1qsjb_

PDB Entry: 1qsj (more details), 1.9 Å

PDB Description: n-terminally truncated c3dg fragment
PDB Compounds: (B:) complement c3 precursor

SCOPe Domain Sequences for d1qsjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsjb_ a.102.4.4 (B:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
ppvvrwlnderyygggygstqatfmvfqalaqyrad

SCOPe Domain Coordinates for d1qsjb_:

Click to download the PDB-style file with coordinates for d1qsjb_.
(The format of our PDB-style files is described here.)

Timeline for d1qsjb_: