SCOP 1.73: Domain d1c3da_: 1c3d A:

Lineage for d1c3da_ (1c3d A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.4: Complement components [48251] (2 proteins)
   probably related to other families, but has no known enzymatic activity

6. Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48253] (3 PDB entries)

8. Domain d1c3da_: 1c3d A: [18874]
   complexed with gol; mutant

Details for d1c3da_

PDB Entry: 1c3d, 1.8 Å

PDB Description: x-ray crystal structure of c3d: a c3 fragment and ligand for complement receptor 2

PDB Compounds: (A:) c3d

SCOP Domain Sequences for d1c3da_:

Sequence; same for both SEQRES and ATOM records:

>d1c3da_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

Timeline for d1c3da_:

• d1c3da_ first appeared (with stable ids) in SCOP 1.55, called d1c3d__
  
• d1c3da_ was called d1c3d__ in SCOP 1.71
  
• d1c3da_ appears in SCOP 1.75
  
• d1c3da_ appears in the current release, SCOPe 2.08, called d1c3da1