SCOP 1.59: Domain d1c3d__: 1c3d -

Lineage for d1c3d__ (1c3d -)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)

4. Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.4: C3D, a C3 fragment and ligand for complement receptor 2 [48251] (1 protein)

6. Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48253] (2 PDB entries)

8. Domain d1c3d__: 1c3d - [18874]

Details for d1c3d__

PDB Entry: 1c3d, 1.8 Å

PDB Description: x-ray crystal structure of c3d: a c3 fragment and ligand for complement receptor 2

SCOP Domain Sequences for d1c3d__:

Sequence; same for both SEQRES and ATOM records:

>d1c3d__ a.102.4.4 (-) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens)}
mldaerlkhlivtpsgageqnmigmtptviavhyldeteqwekfglekrqgalelikkgy
tqqlafrqpssafaafvkrapstwltayvvkvfslavnliaidsqvlcgavkwlilekqk
pdgvfqedapvihqemigglrnnnekdmaltafvlislqeakdiceeqvnslpgsitkag
dfleanymnlqrsytvaiagyalaqmgrlkgpllnkflttakdknrwedpgkqlynveat
syallallqlkdfdfvppvvrwlneqryygggygstqatfmvfqalaqyqkdap

Timeline for d1c3d__:

• d1c3d__ first appeared (with stable ids) in SCOP 1.55
  
• d1c3d__ appears in SCOP 1.57
  
• d1c3d__ appears in SCOP 1.61
  
• d1c3d__ appears in the current release, SCOPe 2.08, called d1c3da1