Lineage for d1dced_ (1dce D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541757Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 541951Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 542076Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 542170Protein Rab geranylgeranyltransferase, beta subunit [48249] (1 species)
  7. 542171Species Rat (Rattus norvegicus) [TaxId:10116] [48250] (2 PDB entries)
  8. 542173Domain d1dced_: 1dce D: [18873]
    Other proteins in same PDB: d1dcea1, d1dcea2, d1dcea3, d1dcec1, d1dcec2, d1dcec3
    complexed with zn

Details for d1dced_

PDB Entry: 1dce (more details), 2 Å

PDB Description: crystal structure of rab geranylgeranyltransferase from rat brain

SCOP Domain Sequences for d1dced_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dced_ a.102.4.3 (D:) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus)}
tqqkdvtiksdapdtlllekhadyiasygskkddyeycmseylrmsgvywgltvmdlmgq
lhrmnkeeilvfikscqhecggvsasighdphllytlsavqiltlydsihvinvdkvvay
vqslqkedgsfagdiwgeidtrfsfcavatlallgkldainvekaiefvlscmnfdggfg
crpgseshagqiycctgflaitsqlhqvnsdllgwwlcerqlpsgglngrpeklpdvcys
wwvlaslkiigrlhwidreklrsfilacqdeetggfadrpgdmvdpfhtlfgiaglsllg
eeqikpvspvfcmpeevlqrvnvqpelvs

SCOP Domain Coordinates for d1dced_:

Click to download the PDB-style file with coordinates for d1dced_.
(The format of our PDB-style files is described here.)

Timeline for d1dced_: