SCOPe 2.01: Domain d1fppb_: 1fpp B:

Lineage for d1fppb_ (1fpp B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (29 PDB entries)
   Uniprot Q02293 22-418 P53610

8. Domain d1fppb_: 1fpp B: [18870]
   Other proteins in same PDB: d1fppa_
   complexed with fpp, po4, zn

Details for d1fppb_

PDB Entry: 1fpp, 2.75 Å

PDB Description: protein farnesyltransferase complex with farnesyl diphosphate

PDB Compounds: (B:) protein farnesyltransferase

SCOPe Domain Sequences for d1fppb_:

Sequence; same for both SEQRES and ATOM records:

>d1fppb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy
lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg
ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv
rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi
lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp
alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam
lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvp

Timeline for d1fppb_:

• d1fppb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fppb_ appears in SCOP 1.75
  
• d1fppb_ appears in SCOPe 2.02
  
• d1fppb_ appears in the current release, SCOPe 2.08