Class a: All alpha proteins [46456] (258 folds) |
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (27 PDB entries) |
Domain d1qbqb_: 1qbq B: [18868] Other proteins in same PDB: d1qbqa_ complexed with ace, act, hfp, zn |
PDB Entry: 1qbq (more details), 2.4 Å
SCOP Domain Sequences for d1qbqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qbqb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
Timeline for d1qbqb_: