Lineage for d1qbqb_ (1qbq B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722636Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 2722637Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 2722652Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 2722726Domain d1qbqb_: 1qbq B: [18868]
    Other proteins in same PDB: d1qbqa_
    complexed with act, hfp, zn

Details for d1qbqb_

PDB Entry: 1qbq (more details), 2.4 Å

PDB Description: structure of rat farnesyl protein transferase complexed with a cvim peptide and alpha-hydroxyfarnesylphosphonic acid.
PDB Compounds: (B:) fpt beta-subunit

SCOPe Domain Sequences for d1qbqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbqb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

SCOPe Domain Coordinates for d1qbqb_:

Click to download the PDB-style file with coordinates for d1qbqb_.
(The format of our PDB-style files is described here.)

Timeline for d1qbqb_: