SCOPe 2.08: Domain d1qbqb_: 1qbq B:

Lineage for d1qbqb_ (1qbq B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
   Uniprot Q02293 22-418 P53610

8. Domain d1qbqb_: 1qbq B: [18868]
   Other proteins in same PDB: d1qbqa_
   complexed with act, hfp, zn

Details for d1qbqb_

PDB Entry: 1qbq, 2.4 Å

PDB Description: structure of rat farnesyl protein transferase complexed with a cvim peptide and alpha-hydroxyfarnesylphosphonic acid.

PDB Compounds: (B:) fpt beta-subunit

SCOPe Domain Sequences for d1qbqb_:

Sequence; same for both SEQRES and ATOM records:

>d1qbqb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

Timeline for d1qbqb_:

• d1qbqb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qbqb_ appears in SCOPe 2.07