SCOP 1.63: Domain d1ft1b_: 1ft1 B:

Lineage for d1ft1b_ (1ft1 B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array

4. Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (14 PDB entries)

8. Domain d1ft1b_: 1ft1 B: [18867]
   Other proteins in same PDB: d1ft1a_
   complexed with zn

Details for d1ft1b_

PDB Entry: 1ft1, 2.25 Å

PDB Description: crystal structure of protein farnesyltransferase at 2.25 angstroms resolution

SCOP Domain Sequences for d1ft1b_:

Sequence; same for both SEQRES and ATOM records:

>d1ft1b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
plyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhy
lkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfg
ggpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdv
rsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvi
lkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdp
alsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgam
lhdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgfeecedavtsdpatd

Timeline for d1ft1b_:

• d1ft1b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ft1b_ appears in SCOP 1.61
  
• d1ft1b_ appears in SCOP 1.65
  
• d1ft1b_ appears in the current release, SCOPe 2.08