SCOP 1.75: Domain d3sqcc1: 3sqc C:10-36,C:308-628

Lineage for d3sqcc1 (3sqc C:10-36,C:308-628)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.2: Terpene synthases [48243] (2 proteins)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Squalene-hopene cyclase [48244] (1 species)

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)

8. Domain d3sqcc1: 3sqc C:10-36,C:308-628 [18864]

Details for d3sqcc1

PDB Entry: 3sqc, 2.8 Å

PDB Description: squalene-hopene cyclase

PDB Compounds: (C:) squalene--hopene cyclase

SCOP Domain Sequences for d3sqcc1:

Sequence; same for both SEQRES and ATOM records:

>d3sqcc1 a.102.4.2 (C:10-36,C:308-628) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew
lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvcdtavvvwalntlrlpderrrrda
mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf
gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka
ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq
ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqai

Timeline for d3sqcc1:

• d3sqcc1 first appeared (with stable ids) in SCOP 1.55
  
• d3sqcc1 appears in SCOP 1.73
  
• d3sqcc1 appears in SCOPe 2.01
  
• d3sqcc1 appears in the current release, SCOPe 2.08