Lineage for d3sqca1 (3sqc A:10-36,A:308-628)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 646026Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 646052Family a.102.4.2: Terpene synthases [48243] (2 proteins)
    consists of two toroid domains: one of six and one of five hairpins
  6. 646059Protein Squalene-hopene cyclase [48244] (1 species)
  7. 646060Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)
  8. 646127Domain d3sqca1: 3sqc A:10-36,A:308-628 [18860]

Details for d3sqca1

PDB Entry: 3sqc (more details), 2.8 Å

PDB Description: squalene-hopene cyclase
PDB Compounds: (A:) squalene--hopene cyclase

SCOP Domain Sequences for d3sqca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sqca1 a.102.4.2 (A:10-36,A:308-628) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew
lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvcdtavvvwalntlrlpderrrrda
mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf
gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka
ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq
ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqai

SCOP Domain Coordinates for d3sqca1:

Click to download the PDB-style file with coordinates for d3sqca1.
(The format of our PDB-style files is described here.)

Timeline for d3sqca1: