Lineage for d1sqc_1 (1sqc 10-36,308-628)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.102: alpha/alpha toroid [48207] (4 superfamilies) Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) 
Family a.102.4.2: Terpene syntases [48243] (1 protein) Protein Squalene-hopene cyclase [48244] (1 species) Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (3 PDB entries) 
Domain d1sqc_1: 1sqc 10-36,308-628 [18858]
Details for d1sqc_1
PDB Entry: 1sqc (more details), 2.85 Å
PDB Description: squalene-hopene-cyclase from alicyclobacillus acidocaldarius
SCOP Domain Sequences for d1sqc_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqc_1 a.102.4.2 (10-36,308-628) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius}
ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew
lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvddtavvvwalntlrlpderrrrda
mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf
gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka
ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq
ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqai
SCOP Domain Coordinates for d1sqc_1:
Click to download the PDB-style file with coordinates for d1sqc_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sqc_1:
- d1sqc_1 appears in SCOP 1.57
- d1sqc_1 appears in the current release, SCOPe 2.08, called d1sqca1
View in 3D
