SCOPe 2.08: Domain d1sqca1: 1sqc A:10-36,A:308-628

Lineage for d1sqca1 (1sqc A:10-36,A:308-628)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.2: Terpene synthases [48243] (3 proteins)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Squalene-hopene cyclase [48244] (1 species)

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)

8. Domain d1sqca1: 1sqc A:10-36,A:308-628 [18858]
   complexed with lda

Details for d1sqca1

PDB Entry: 1sqc, 2.85 Å

PDB Description: squalene-hopene-cyclase from alicyclobacillus acidocaldarius

PDB Compounds: (A:) squalene-hopene cyclase

SCOPe Domain Sequences for d1sqca1:

Sequence; same for both SEQRES and ATOM records:

>d1sqca1 a.102.4.2 (A:10-36,A:308-628) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew
lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvddtavvvwalntlrlpderrrrda
mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf
gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka
ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq
ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqai

Timeline for d1sqca1:

• d1sqca1 first appeared (with stable ids) in SCOP 1.55, called d1sqc_1
  
• d1sqca1 appears in SCOPe 2.07