SCOPe 2.08: Domain d2sqcb1: 2sqc B:8-36,B:308-630

Lineage for d2sqcb1 (2sqc B:8-36,B:308-630)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.2: Terpene synthases [48243] (3 proteins)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Squalene-hopene cyclase [48244] (1 species)

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)

8. Domain d2sqcb1: 2sqc B:8-36,B:308-630 [18856]
   complexed with c8e

Details for d2sqcb1

PDB Entry: 2sqc, 2 Å

PDB Description: squalene-hopene cyclase from alicyclobacillus acidocaldarius

PDB Compounds: (B:) squalene-hopene cyclase

SCOPe Domain Sequences for d2sqcb1:

Sequence; same for both SEQRES and ATOM records:

>d2sqcb1 a.102.4.2 (B:8-36,B:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
apayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkag
ewlldrqitvpgdwavkrpnlkpggfafqfdnvyypdvcdtavvvwalntlrlpderrrr
damtkgfrwivgmqssnggwgaydvdntsdlpnhipfsdfgevtdppsedvtahvlecfg
sfgyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiq
kaldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrg
vqylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqaier

Timeline for d2sqcb1:

• d2sqcb1 first appeared (with stable ids) in SCOP 1.55
  
• d2sqcb1 appears in SCOPe 2.07