Lineage for d5eat_1 (5eat 17-220)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.102: alpha/alpha toroid [48207] (4 superfamilies) Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) 
Family a.102.4.1: 5-Epi-aristolochene synthase, N-terminal domain [48240] (1 protein) Protein 5-Epi-aristolochene synthase, N-terminal domain [48241] (1 species) Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48242] (3 PDB entries) 
Domain d5eat_1: 5eat 17-220 [18853]
Other proteins in same PDB: d5eat_2
Details for d5eat_1
PDB Entry: 5eat (more details), 2.8 Å
PDB Description: 5-epi-aristolochene synthase from nicotiana tabacum with substrate analog farnesyl hydroxyphosphonate
SCOP Domain Sequences for d5eat_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eat_1 a.102.4.1 (17-220) 5-Epi-aristolochene synthase, N-terminal domain {Tobacco (Nicotiana tabacum)}
vadfspslwgdqflsfsidnqvaekyaqeiealkeqtrsmllatgrkladtlnlidiier
lgisyhfekeideildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdengkf
keslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthaleq
clhkgvprvetrffissiydkeqs
SCOP Domain Coordinates for d5eat_1:
Click to download the PDB-style file with coordinates for d5eat_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5eat_1:
- d5eat_1 appears in SCOP 1.57
- d5eat_1 appears in the current release, SCOPe 2.08, called d5eata1
View in 3D
