Lineage for d5easa1 (5eas A:24-220)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335598Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2335599Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
    incomplete toroid made of four hairpins
    automatically mapped to Pfam PF01397
  6. 2335615Protein 5-Epi-aristolochene synthase [48241] (1 species)
  7. 2335616Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48242] (7 PDB entries)
  8. 2335618Domain d5easa1: 5eas A:24-220 [18852]
    Other proteins in same PDB: d5easa2
    complexed with mg

Details for d5easa1

PDB Entry: 5eas (more details), 2.25 Å

PDB Description: 5-epi-aristolochene synthase from nicotiana tabacum
PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d5easa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5easa1 a.102.4.1 (A:24-220) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
lwgdqflsfsidnqvaekyaqeiealkeqtrsmllatgrkladtlnlidiierlgisyhf
ekeideildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdengkfkeslasd
vlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthaleqclhkgvp
rvetrffissiydkeqs

SCOPe Domain Coordinates for d5easa1:

Click to download the PDB-style file with coordinates for d5easa1.
(The format of our PDB-style files is described here.)

Timeline for d5easa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5easa2