SCOPe 2.05: Domain d5eaua1: 5eau A:21-220

Lineage for d5eaua1 (5eau A:21-220)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (3 proteins)
   incomplete toroid made of four hairpins
   automatically mapped to Pfam PF01397

6. Protein 5-Epi-aristolochene synthase [48241] (1 species)

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48242] (7 PDB entries)

8. Domain d5eaua1: 5eau A:21-220 [18851]
   Other proteins in same PDB: d5eaua2
   complexed with fff, mg

Details for d5eaua1

PDB Entry: 5eau, 2.15 Å

PDB Description: 5-epi-aristolochene synthase from nicotiana tabacum

PDB Compounds: (A:) 5-epi-aristolochene synthase

SCOPe Domain Sequences for d5eaua1:

Sequence; same for both SEQRES and ATOM records:

>d5eaua1 a.102.4.1 (A:21-220) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
spslwgdqflsfsidnqvaekyakeiealkeqtrnmllatgmkladtlnlidtierlgis
yhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdengkfkesl
asdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthaleqclhk
gvprvetrffissiydkeqs

Timeline for d5eaua1:

• d5eaua1 first appeared (with stable ids) in SCOP 1.55, called d5eau_1
  
• d5eaua1 appears in SCOPe 2.04
  
• d5eaua1 appears in SCOPe 2.06
  
• d5eaua1 appears in the current release, SCOPe 2.08