![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) ![]() |
![]() | Family a.102.4.1: Terpenoid cyclase N-terminal domain [48240] (2 proteins) incomplete toroid made of four hairpins |
![]() | Protein 5-Epi-aristolochene synthase [48241] (1 species) |
![]() | Species Tobacco (Nicotiana tabacum) [TaxId:4097] [48242] (7 PDB entries) |
![]() | Domain d5eaua1: 5eau A:21-220 [18851] Other proteins in same PDB: d5eaua2 complexed with fff, mg; mutant |
PDB Entry: 5eau (more details), 2.15 Å
SCOP Domain Sequences for d5eaua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eaua1 a.102.4.1 (A:21-220) 5-Epi-aristolochene synthase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} spslwgdqflsfsidnqvaekyakeiealkeqtrnmllatgmkladtlnlidtierlgis yhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdengkfkesl asdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthaleqclhk gvprvetrffissiydkeqs
Timeline for d5eaua1: